PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E01688.1.p
Common NameMIMGU_mgv1a018163mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 247aa    MW: 26953.2 Da    PI: 5.1345
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E01688.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB120.57.5e-3864155293
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       re d+++P +n++rim+ vlP + ki++dake +q cvsefi f+t++a+++c+r+ rkt++++d+l a+++lGf dy++pl v+l+k r  
  Migut.E01688.1.p  64 READQYMPTTNIARIMRCVLPDHVKIADDAKEAIQVCVSEFINFITADANNRCHRDYRKTVTPEDVLAAMTSLGFGDYIDPLIVFLNKNRAQ 155
                       899*************************************************************************************9964 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.8E-3957162IPR009072Histone-fold
SuperFamilySSF471131.61E-2967161IPR009072Histone-fold
PfamPF008081.2E-1969133IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.1E-1097115No hitNo description
PRINTSPR006154.1E-10116134No hitNo description
PRINTSPR006154.1E-10135153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MERGGISNIE HKYTRRAGTS GIVIREGGVP NVVATATNVV NIPDAPTNAT PEEVNQEQHQ  60
GVKREADQYM PTTNIARIMR CVLPDHVKIA DDAKEAIQVC VSEFINFITA DANNRCHRDY  120
RKTVTPEDVL AAMTSLGFGD YIDPLIVFLN KNRAQQDLER DDDNGGFVHH QQPQGAHMVR  180
SPPAPAPLVA PTMGYYVPLP PPVAGTMEKG EELGGSTRAI NAYMSCNYGR GEGSSESPEF  240
DPFQKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-3164153392NF-YB
4awl_B6e-3164153493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-3164153493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012841021.11e-149PREDICTED: nuclear transcription factor Y subunit beta-like
TrEMBLA0A022R3391e-162A0A022R339_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.11e-39NF-YB family protein